Guides

Guides and glossary

4 guides · 31 compounds · research use only

Four short guides on the documents and the material — how to read a certificate, how to tie it to a lot, how to keep a lyophilised peptide in specification, and what a consignment contains — followed by a glossary of every compound in the catalogue, each described by what it is: sequence, length, origin and form.

01Reading a Certificate of AnalysisWhat each section of a lot certificate means — identity by mass, purity by chromatogram, peptide content, and what the document does not say.Read the guide →02Verifying a lotFive fields on the label, the same five on the certificate. How to confirm that the certificate describes the vial on the bench.Read the guide →03Storage and handling of lyophilised peptidesTemperature, moisture and light for the sealed vial; what the expiry date means; what to do on receipt.Read the guide →04What arrives in the boxThe carton, the vials, the label, and the documents that travel with every consignment — and which one to keep with the vial.Read the guide →

Compound glossary

Every entry describes the molecule — what it is, not what it does. The same text appears at the head of each product page. Classes: Peptide — bioregulator · Peptide — cosmetic sequence · Peptide — growth factor / secretagogue · Peptide — metabolic · Peptide — neuroactive sequence · Peptide — partial sequence · Reagent — solvent.

Peptide — bioregulator

5-AMINO-1MQDHN-P-1001: 5-Amino-1-methylquinolinium (5-AMINO-1MQ) is a small-molecule quinolinium salt rather than a peptide; the supplying facility files it with the bioregulator class. Characterised in vitro as a ligand of the enzyme nicotinamide N-methyltransferase (NNMT). Supplied as a lyophilised solid for laboratory research use only.
CartalaxDHN-P-1023AED · 3 aa: Cartalax is a synthetic tripeptide, Ala-Glu-Asp, of the Khavinson bioregulator series developed at the St Petersburg Institute of Bioregulation and Gerontology. Supplied as a lyophilised powder for in vitro laboratory investigation.
EpithalonDHN-P-1030AEDG · 4 aa: Epithalon (epitalon) is a synthetic tetrapeptide, Ala-Glu-Asp-Gly, designed as a short analogue of the pineal extract epithalamin within the Khavinson bioregulator series. Supplied as a lyophilised powder for in vitro laboratory investigation.
KLOWDHN-P-1050: KLOW is the supplying facility's designation for a multi-compound presentation lyophilised together at 80 mg total per vial; the components and their proportions are stated on the vial label and the lot certificate. For in vitro laboratory investigation only.
NAD+DHN-P-1066: NAD+ (nicotinamide adenine dinucleotide, oxidised form) is a dinucleotide coenzyme present in every living cell and not a peptide; the supplying facility files it with the bioregulator class. Supplied as a lyophilised powder for in vitro laboratory investigation.
PinealonDHN-P-1077EDR · 3 aa: Pinealon is a synthetic tripeptide, Glu-Asp-Arg, of the Khavinson bioregulator series. Supplied as a lyophilised powder for in vitro laboratory investigation.

Peptide — cosmetic sequence

GlutathioneDHN-P-1040γE-C-G · 3 aa: Glutathione (GSH) is the tripeptide γ-L-glutamyl-L-cysteinylglycine, present in most cells and notable for its unusual γ-peptide bond and free thiol group. Supplied in the reduced form as a lyophilised powder for in vitro laboratory investigation.
Melanotan IDHN-P-1063Ac-S-Y-S-Nle-E-H-(D-F)-R-W-G-K-P-V-NH2 · 13 aa: Melanotan I (afamelanotide) is a synthetic 13-residue linear analogue of α-melanocyte-stimulating hormone carrying two substitutions, Nle4 and D-Phe7. Supplied as a lyophilised powder for in vitro laboratory investigation.
Melanotan IIDHN-P-1064Ac-Nle-cyclo[D-H-(D-F)-R-W-K]-NH2 · 7 aa: Melanotan II is a synthetic cyclic heptapeptide analogue of α-melanocyte-stimulating hormone, closed by a lactam bridge between Asp and Lys side chains. Supplied as a lyophilised powder for in vitro laboratory investigation.
PT141DHN-P-1075Ac-Nle-cyclo[D-H-(D-F)-R-W-K]-OH · 7 aa: PT-141 (bremelanotide) is a synthetic cyclic heptapeptide analogue of α-melanocyte-stimulating hormone, derived from Melanotan II by removal of the C-terminal amide. Supplied as a lyophilised powder for in vitro laboratory investigation.

Peptide — growth factor / secretagogue

CJC-1295 (no DAC) 5mg + Ipamorelin 5mgDHN-P-1015: A two-compound presentation: CJC-1295 without DAC (a modified 29-residue analogue of the 1–29 fragment of growth hormone-releasing hormone) and ipamorelin (a synthetic pentapeptide), lyophilised together at 5 mg of each per vial. Each component is also listed separately in this catalogue with its own record. For in vitro laboratory investigation only.
CJC-1295 (without DAC)DHN-P-1017Y-(D-A)-D-A-I-F-T-Q-S-Y-R-K-V-L-A-Q-L-S-A-R-K-L-L-Q-D-I-L-S-R-NH2 · 29 aa: CJC-1295 without DAC, also listed as Mod GRF (1-29), is a synthetic 29-residue analogue of the 1–29 fragment of growth hormone-releasing hormone carrying four amino-acid substitutions and no drug-affinity-complex group. Supplied as a lyophilised powder for in vitro laboratory investigation.
IpamorelinDHN-P-1049Aib-H-(D-2Nal)-(D-F)-K-NH2 · 5 aa: Ipamorelin is a synthetic pentapeptide, Aib-His-D-2-Nal-D-Phe-Lys-NH2, characterised as a ligand of the GHS-R1a (ghrelin) receptor and filed under the growth factor / secretagogue class. Supplied as a lyophilised powder for in vitro laboratory investigation.
Sermorelin AcetateDHN-P-1086YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 · 29 aa: Sermorelin is the synthetic 29-residue N-terminal fragment (1–29) of human growth hormone-releasing hormone, supplied here as the acetate salt. Lyophilised powder for in vitro laboratory investigation.
TesamorelinDHN-P-1089(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 · 44 aa: Tesamorelin is a synthetic 44-residue analogue of human growth hormone-releasing hormone (1–44) with a trans-3-hexenoyl group on the N-terminal tyrosine. Supplied as a lyophilised powder for in vitro laboratory investigation.

Peptide — metabolic

MOTS-c (human)DHN-P-1060MRWQEMGYIFYPRKLR · 16 aa: MOTS-c is a 16-residue peptide encoded within the mitochondrial 12S rRNA gene — one of the mitochondrial-derived peptides — with the human sequence MRWQEMGYIFYPRKLR. Supplied as a lyophilised powder for in vitro laboratory investigation.

Peptide — neuroactive sequence

DihexaDHN-P-2002Hexanoyl-Y-I-(6-aminohexanoyl)-NH2 · 2 aa: Dihexa (N-hexanoic-Tyr-Ile-(6)-aminohexanoic amide) is a synthetic peptide-derived small molecule developed from the angiotensin IV sequence at Washington State University. Supplied as a lyophilised powder for in vitro laboratory investigation.
DSIPDHN-P-1026WAGGDASGE · 9 aa: Delta sleep-inducing peptide (DSIP) is a naturally occurring nonapeptide, sequence WAGGDASGE, first isolated from rabbit cerebral venous blood in 1977. Supplied as a lyophilised powder for in vitro laboratory investigation.
SelankDHN-P-1083TKPRPGP · 7 aa: Selank is a synthetic heptapeptide, Thr-Lys-Pro-Arg-Pro-Gly-Pro, built from the tuftsin sequence (TKPR) with a C-terminal Pro-Gly-Pro extension; developed at the Institute of Molecular Genetics, Moscow. Supplied as a lyophilised powder for in vitro laboratory investigation.
Selank 5mg + Semax 5mgDHN-P-2003: A two-compound presentation of Selank and Semax lyophilised together at 5 mg of each per vial. Both components are listed separately in this catalogue with their own records. For in vitro laboratory investigation only.
SemaxDHN-P-1085MEHFPGP · 7 aa: Semax is a synthetic heptapeptide, Met-Glu-His-Phe-Pro-Gly-Pro, comprising the 4–7 fragment of adrenocorticotropic hormone with a C-terminal Pro-Gly-Pro extension; developed at the Institute of Molecular Genetics, Moscow. Supplied as a lyophilised powder for in vitro laboratory investigation.

Peptide — partial sequence

ARA-290 (Cibinetide)DHN-P-1007pE-E-Q-L-E-R-A-L-N-S-S · 11 aa: ARA-290 (cibinetide) is a synthetic eleven-residue peptide modelled on helix B of erythropoietin — a linear sequence derived from the tertiary structure of the parent protein rather than a fragment cut from it. Supplied as a lyophilised powder for in vitro laboratory investigation.
BPC-157DHN-P-0157GEPPPGKPADDAGLV · 15 aa: BPC-157 is a synthetic pentadecapeptide — fifteen residues, sequence GEPPPGKPADDAGLV — whose sequence is a partial fragment of a protein first isolated from human gastric juice. Supplied as a lyophilised acetate salt for in vitro laboratory investigation, with a Certificate of Analysis issued per lot.
BPC-157 / GHK-Cu / TB-500 blend, 70mgDHN-P-1039: A three-compound presentation of BPC-157, GHK-Cu and TB-500 lyophilised together at 70 mg total per vial; the proportion of each component is stated on the vial label and the lot certificate. Each component is listed separately in this catalogue with its own record. For in vitro laboratory investigation only.
BPC-157 / TB-500 blend, 10mgDHN-P-1096: A two-compound presentation of BPC-157 and TB-500 lyophilised together at 10 mg total per vial; the proportion of each is stated on the vial label and the lot certificate. Both components are listed separately in this catalogue with their own records. For in vitro laboratory investigation only.
BPC-157 / TB-500 blend, 20mgDHN-P-1097: A two-compound presentation of BPC-157 and TB-500 lyophilised together at 20 mg total per vial; the proportion of each is stated on the vial label and the lot certificate. Both components are listed separately in this catalogue with their own records. For in vitro laboratory investigation only.
BPC-157 / TB-500 blend, 5mgDHN-P-2004: A two-compound presentation of BPC-157 and TB-500 lyophilised together at 5 mg total per vial; the proportion of each is stated on the vial label and the lot certificate. Both components are listed separately in this catalogue with their own records. For in vitro laboratory investigation only.
GHK-CuDHN-P-1036GHK (Cu²⁺ complex) · 3 aa: GHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, a sequence first identified in human plasma in 1973. Supplied as a lyophilised, blue-tinted powder for in vitro laboratory investigation; the copper complex is the form listed, not the free peptide.
KPVDHN-P-1051KPV · 3 aa: KPV is the tripeptide Lys-Pro-Val, the three C-terminal residues (11–13) of α-melanocyte-stimulating hormone. Supplied as a lyophilised powder for in vitro laboratory investigation.
TB-500DHN-P-1088Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-OH · 43 aa: TB-500 is the research designation for synthetic thymosin β4, a 43-residue actin-binding peptide first isolated from calf thymus. Supplied as a lyophilised powder for in vitro laboratory investigation.

Reagent — solvent

Bacteriostatic waterDHN-P-1013: Bacteriostatic water is sterile water for laboratory use containing 0.9% benzyl alcohol as a preservative, supplied in 30 ml multi-use vials. A reagent line, listed with the solvents and sold on its own record.

A compound absent from this list is either not yet described or not on the published catalogue. Descriptions are identity only, and are checked against the same rules as every other page.