Dohrna Research Supplies Limited · Malta reg. C 116978Laboratory research use only · Prices in USD
Basket
Sermorelin Acetate, 5mg — vial as supplied

Growth factors & secretagoguesCat. DHN-P-1086

Sermorelin Acetate

Sermorelin is the synthetic 29-residue N-terminal fragment (1–29) of human growth hormone-releasing hormone, supplied here as the acetate salt. Lyophilised powder for in vitro laboratory investigation.

Form
Lyophilised powder
Purity
Per lot, on the CoA
Storage
−20 °C, desiccated, dark
Made in
the United States

More in Growth factors & secretagoguesSee the class →

Certificate of Analysis

Issued per lot by an independent ISO/IEC 17025 laboratory. Lot number on the vial label.

Certificate of Analysis — Sermorelin Acetate, lot as printed on the vial label.

The certificate for the current lot is published here on release.Every figure on it is measured on that lot by the testing laboratory. Nothing is shown in its place — no specimen, no figure from another lot.

Questions about this line

What is Sermorelin Acetate?

Sermorelin is the synthetic 29-residue N-terminal fragment (1–29) of human growth hormone-releasing hormone, supplied here as the acetate salt. Lyophilised powder for in vitro laboratory investigation.

What arrives with an order of Sermorelin Acetate?

Each vial ships as a lyophilised powder in a crimped glass vial, with the Certificate of Analysis for its lot, the Safety Data Sheet, and the lot number printed on the label. The documentation centre lists each document in full.

How is Sermorelin Acetate stored?

Unopened, at −20 °C, desiccated and protected from light. The retest interval for the lot is stated on its certificate.

Which sizes and quantities are sold?

Single vials of 5mg, 10mg, 15mg, 10 × 5mg (box of 10), in quantities of one, five or ten. Twenty-five or more are quoted on enquiry.

Where can Sermorelin Acetate be delivered?

To United States delivery addresses. Every order is checked against this compound’s own destination list before it is recorded; the full position is on the shipping and destinations page.

Is the certificate available before ordering?

The Certificate of Analysis is issued per lot by the testing laboratory and published on this page when the lot is released. A certificate is valid only for the lot whose number is printed on the vial label; no certificate from another lot is shown in its place.

Specification

Chemical identity, sequence, form and handling — the full record for this line
Chemical namePending PubChem verification
SynonymsPending PubChem verification
CAS number86168-78-7
PubChem CIDPending PubChem verification
Molecular formulaC149H246N44O42S
Molecular weight3357.88 g·mol⁻¹ (average, free base)
Sequence (one-letter)YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Sequence (three-letter)H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Residues29
Counter-ionConfirmed per lot on the CoA
Purity specificationStated on the CoA for the supplied lot
Physical formLyophilised powder
AppearanceStated on the CoA for the supplied lot
SolubilityStated on the product datasheet
Storage−20 °C, desiccated, protected from light
Shipping conditionAmbient; lyophilisate stable for short-duration transit
Retest intervalStated on the CoA for the supplied lot
Current lotAssigned at dispatch; printed on the vial label and the CoA
Chemical identity is a property of the compound and does not vary between lots. Measured values for the lot on sale are published on its certificate.

Analytical data — certificate field layout

The 21 lot fields the certificate above reports, populated per lot from the issuing laboratory
Certificate of Analysis

Field layout of the lot certificate. Measured values appear only from the issuing laboratory's signed document.

LOT populated per lot from the signed certificate
Every figure in this table is measured on a single lot and is published from the issuing laboratory's signed certificate. The certificate for the lot currently on sale has not been returned yet, so no figure is shown. Nothing is estimated, carried over from another lot, or shown as an illustration.
Testing laboratorypopulated per lot from the signed certificate · ISO/IEC 17025 accreditation populated per lot from the signed certificate
Lot numberpopulated per lot from the signed certificate — must match the vial label exactly
Date of manufacturepopulated per lot from the signed certificate
COA issue datepopulated per lot from the signed certificate
Retest datepopulated per lot from the signed certificate
Purity (RP-HPLC, 214 nm)populated per lot from the signed certificate · spec populated per lot from the signed certificate
HPLC columnpopulated per lot from the signed certificate
Mobile phase / gradientpopulated per lot from the signed certificate
Flow rate · detectionpopulated per lot from the signed certificate · 214 nm
Retention timepopulated per lot from the signed certificate
Chromatogrampopulated per lot from the signed certificate — trace image required, not a summary figure
MS theoretical mass3357.88 g·mol⁻¹ (average, free base) average · populated per lot from the signed certificate monoisotopic
MS observed [M+H]+populated per lot from the signed certificate
Mass accuracypopulated per lot from the signed certificate ppm · target < 5 ppm
Amino acid analysispopulated per lot from the signed certificate
Peptide content (N determination)populated per lot from the signed certificate
Water content (Karl Fischer)populated per lot from the signed certificate
Residual solvents (ICH Q3C)populated per lot from the signed certificate
Endotoxinpopulated per lot from the signed certificate
Heavy metals (ICP-MS)populated per lot from the signed certificate
Released bypopulated per lot from the signed certificate, populated per lot from the signed certificate
populated per lot from the signed certificate

Chromatogram trace region — placeholder. The trace image is published here from the signed Certificate of Analysis when the issuing laboratory returns it. No illustrative trace is shown in its place.

Documentation

Certificate of Analysis, Safety Data Sheets and datasheet for this line
COACertificate of AnalysisIssued per lot, retrievable by the lot number on the labelDSProduct datasheetHandling and storage · issued with the unitToSTerms of SaleIncl. research-use policy

Safety Data Sheets. The required language set below is derived from this compound's destination allow-list, so opening a new destination adds its language here automatically.

REACH Art. 31 requires the Safety Data Sheet in an official language of each Member State where the substance is placed on the market, supplied free of charge no later than first supply, with updates sent to all recipients from the previous 12 months. An English-only Safety Data Sheet is not compliant for a pan-EU catalogue.

Compliance and supply record

The formal record for this line — hazard labelling, traceability, supply controls, citations and terms of supply

Regulatory status and supply controls

Marketing authorisation
None — no marketing authorisation as a medicinal product in any EU/EEA Member State or in the United Kingdom
WADA Prohibited List
No determination obtained — none asserted
LegitScript
Application not yet made — no clearance asserted
Supply channel
Declared research accounts only
Malta borderline determination
No determination obtained — none asserted
Customs classification
CN code assigned at first export

Statement of position. This compound holds no marketing authorisation as a medicinal product in any EU/EEA Member State or in the United Kingdom. It is not offered, and may not be used, for any human or veterinary application. Every order carries a research-use declaration signed by name, is screened against sanctions and embargo lists, and is checked line by line against the destination policy published for the compound.

Destinations served for this compound — the published list operates as an allow-list. Destinations not listed are not served.

United States

Destinations not served for this compound — determined by destination-state medicines and anti-doping law, not by carrier availability:

Determined with the allow-list above.
Destination policy legal sign-offCounsel sign-off pending — the allow-list is not asserted until obtained
Quantity ceilingSet per line before ordering opens
Destination policy is an allow-list. The checkout country selector is generated from this list per SKU and cannot be altered by the customer. Reg. (EU) 2018/302 Art. 1(5) expressly does not require supply where supply would breach a destination-state prohibition.

Hazard classification and labelling — CLP Regulation (EC) 1272/2008

A hazard classification has not yet been carried out for this substance. Hazard statements and pictograms are published here once it has been. None is shown in the meantime: a classification copied from another supplier, or guessed, would be worse than an absent one.
PictogramsAssessment pending — no classification asserted
Signal wordAssessment pending
Hazard statements (full text)Assessment pending — none asserted
Supplemental (EUH)Assessment pending — none asserted
Precautionary statements (full text)Assessment pending — none asserted
UFIAssigned on classification — required for classified mixtures
C&L Inventory notificationDue on placing on the market — due within 1 month of placing on the market
Poison Centre notificationDue on classification as a mixture — harmonised format, mandatory since 1 January 2025
Revised CLP (EU) 2024/2865 Art. 48a requires pictograms, signal word and the full text of H-, EUH- and P-statements to be displayed on the online offer itself. A link to a downloadable Safety Data Sheet does not satisfy this. Always follow the information on the product label.

Product safety and traceability — Regulation (EU) 2023/988 (GPSR) Art. 19

ManufacturerPublished before first supply (GPSR Art. 19)
Manufacturer postal addressPublished before first supply
Manufacturer electronic addressPublished before first supply
EU responsible economic operatorDohrna Research Supplies Limited, 4th Floor Kingsway Palace, Triq ir-Repubblika, Valletta VLT 1115, Malta
Responsible operator designatedDesignation not yet published
Responsible operator contactsafety@dohrna.com
Product identifierDHN-P-1086 · lot number on the vial label
Technical file retention10 years from placing on the market
Safety warningsProvided in an official language of each Member State of destination. See the Documentation panel.

Literature

Citations are listed by identifier only. Findings are deliberately not summarised, characterised or paraphrased — a description of an effect is a claim regardless of the tense it is written in.

Citations for this line are being curated from PubMed and are published here as author, journal and year with DOI and PMID — identifiers only.

The literature list is compiled from PubMed and published as author / journal / year / DOI / PMID only. No abstracts, no excerpts, no outcome language, and no linking to third-party sites that describe human use — MHRA Guidance Note 8 regards an outbound link to substance-use information as admissible evidence of presentation, and Visa requires acquirers to examine outbound links as part of the site examination.

Conditions of supply

This product is supplied for laboratory research use only, by and for qualified personnel trained in laboratory procedures and familiar with the potential hazards of the material. It is not supplied for human or veterinary use, for pharmaceutical, diagnostic or therapeutic use, or for household, food, cosmetic or agricultural use. It has not been evaluated by any medicines regulator for safety or efficacy in humans or animals.

Buyer warranty. By placing an order the Buyer represents and warrants that: (a) it is acquiring the Products in the course of a trade, business, craft or profession and not as a consumer; (b) the Products will be used solely for in vitro laboratory research; (c) the Products will not be administered to humans or animals, resold to the general public, or incorporated into any product for human or animal use; (d) the person placing the order is at least 18 years of age and is authorised to bind the Buyer; and (e) the Buyer will comply with all applicable medicines, chemicals, health-and-safety, export-control and sanctions laws in its jurisdiction.

The Buyer is responsible for determining the suitability of the product for its intended research use, for testing it, and for its safe handling, storage and disposal. Resale or onward transfer is prohibited without prior written permission.

Priced and supplied for United States delivery addresses. Supply elsewhere is quoted on enquiry. Switch region

$42.00 USD

Size

$8.40 per mgThe 15mg works out 34% cheaper per mg

Vials

25 vials or moreLarger quantities of this line are quoted directly, with lot documentation.Ask for a quote
View order and check out
Delivery $20.00 per order, however many lines it carries. No minimum order.
For laboratory research use only. Not for human or veterinary use. Not for use in diagnostic or therapeutic procedures.

Independent laboratory analysis — ISO/IEC 17025, per lot

Ordering requirements and merchant facts
Generated from this compound's allow-list; confirmed at order handling.
Research-use declaration signed by name with every order
Destination checked line by line against this compound's allow-list
Sanctions and embargo screening on the delivery destination
Delivery to the address on the order — a laboratory, an institution or, within the United States, a residential address. PO boxes are not served
Every line re-priced from the published record before it is recorded
Order within the published quantity ceiling for this compound
Merchant outlet country: Malta
Charge will appear as: DOHRNA RESEARCH REAGENTS
Refunds and returns policy is presented in full, with acknowledgement required, before the order is confirmed.
Restricted destinations apply to this compound — see Regulatory status.
Delivery tracked and signed for. 3-D Secure 2 authentication applies to every transaction.